-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Podoplanin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 63-162 of human Podoplanin (Q86YL7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Podoplanin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 63-162 of human Podoplanin (Q86YL7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16140A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Podoplanin |
| Target Synonyms | T1A; GP36; GP40; Gp38; OTS8; T1A2; TI1A; D2-40; T1A-2; AGGRUS; HT1A-1; PA2.26; Podoplanin | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, U-87MG, U2OS | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 63-162 of human Podoplanin (Q86YL7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP | Uniprot ID | Q86YL7 |
Uniprot Id
Q86YL7
Target Species
Human
Target Name
PDPN
Target Full Name
Podoplanin
Target Function
Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation. Interaction with CD9, on the contrary, attenuates platelet aggregation induced by PDPN. Through MSN or EZR interaction promotes epithelial-mesenchymal transition (EMT) leading to ERZ phosphorylation and triggering RHOA activation leading to cell migration increase and invasiveness. Interaction with CD44 promotes directional cell migration in epithelial and tumor cells. In lymph nodes (LNs), controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix (ECM) and contraction of the actomyosin by maintaining ERM proteins (EZR; MSN and RDX) and MYL9 activation through association with unknown transmembrane proteins. Engagement of CLEC1B by PDPN promotes FRCs relaxation by blocking lateral membrane interactions leading to reduction of ERM proteins (EZR; MSN and RDX) and MYL9 activation. Through binding with LGALS8 may participate in connection of the lymphatic endothelium to the surrounding extracellular matrix. In keratinocytes, induces changes in cell morphology showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. Controls invadopodia stability and maturation leading to efficient degradation of the extracellular matrix (ECM) in tumor cells through modulation of RHOC activity in order to activate ROCK1/ROCK2 and LIMK1/LIMK2 and inactivation of CFL1. Required for normal lung cell proliferation and alveolus formation at birth. Does not function as a water channel or as a regulator of aquaporin-type water channels. Does not have any effect on folic acid or amino acid transport.
Target Subcellular Location
[Podoplanin]: Membrane; Single-pass type I membrane protein. Cell projection, lamellipodium membrane; Single-pass type I membrane protein. Cell projection, filopodium membrane; Single-pass type I membrane protein. Cell projection, microvillus membrane; Single-pass type I membrane protein. Cell projection, ruffle membrane; Single-pass type I membrane protein. Membrane raft. Apical cell membrane. Basolateral cell membrane. Cell projection, invadopodium.; [29kDa cytosolic podoplanin intracellular domain]: Cytoplasm, cytosol.
Target Protein Families
Podoplanin family
Target Tissue Specificity
Highly expressed in placenta, lung, skeletal muscle and brain. Weakly expressed in brain, kidney and liver. In placenta, expressed on the apical plasma membrane of endothelium. In lung, expressed in alveolar epithelium. Up-regulated in colorectal tumors a
Target Synonyms
Aggrus; Glycoprotein 36 KD; Glycoprotein 36; gp 36; GP 38; GP 40; gp36; GP38; GP40; HT1A 1; HT1A1; hT1alpha 1; hT1alpha 2; hT1alpha1; hT1alpha2; Lung type I cell membrane associated glycoprotein; Lung type I cell membrane associated glycoprotein isoform a; Lung type I cell membrane associated glycoprotein T1A 2; OTS 8; OTS8; OTTHUMP00000009640; OTTHUMP00000044504; PA2.26; PA2.26 antigen; Pdpn; PDPN_HUMAN; Podoplanin; PSEC0003; PSEC0025; T1 alpha; T1 ALPHA GENE; T1-alpha; T1A 2; T1A; TI1A; TIA 2; TIA2
Target Background
This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification