-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Prostatic Acid Phosphatase (ACPP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prostatic Acid Phosphatase(PAP/ACPP) (P15309) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Prostatic Acid Phosphatase (ACPP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prostatic Acid Phosphatase(PAP/ACPP) (P15309) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14301A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Prostatic Acid Phosphatase (ACPP) |
| Target Synonyms | ACPP; 5'-NT; ACP-3; TM-PAP; Prostatic Acid Phosphatase (ACPP) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prostatic Acid Phosphatase(PAP/ACPP) (P15309). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHE | Uniprot ID | P15309 |
Uniprot Id
P15309
Target Species
Human
Target Name
ACP3
Target Full Name
Prostatic acid phosphatase
Target Function
A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma.; Tyrosine phosphatase that acts as a tumor suppressor of prostate cancer through dephosphorylation of ERBB2 and deactivation of MAPK-mediated signaling. In addition to its tyrosine phosphatase activity has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor.; (Microbial infection) Forms amyloid beta-sheet fibrils in semen. These fibrils, termed SEVI (semen-derived enhancer of viral infection) capture HIV virions, attach them to target cells and enhance infection. SEVI amyloid fibrils are degraded by polyphenol epigallocatechin-3-gallate (EGCG), a constituent of green tea. Target cell attachment and enhancement of HIV infection is inhibited by surfen. Also similarly boosts XMRV (xenotropic murine leukemia virus-related virus) infection.
Target Subcellular Location
[Isoform 1]: Secreted.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Nucleus. Cytoplasm, cytosol.
Target Protein Families
Histidine acid phosphatase family
Target Tissue Specificity
Highly expressed in the prostate, restricted to glandular and ductal epithelial cells. Also expressed in bladder, kidney, pancreas, lung, cervix, testis and ovary. Weak expression in a subset of pancreatic islet cells, squamous epithelia, the pilosebaceou
Target Research Area
Cancer
Target Synonyms
ACPP; 5'-NT; ACP-3; TM-PAP; Prostatic Acid Phosphatase (ACPP)
Target Background
This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced transcript variant encoding a longer isoform has been found for this gene. This isoform contains a transmembrane domain and is localized in the plasma membrane-endosomal-lysosomal pathway.
Notification