-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRPF31 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PRPF31 (Q8WWY3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRPF31 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PRPF31 (Q8WWY3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13291A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRPF31 |
| Target Synonyms | RP11; PRP31; SNRNP61; NY-BR-99; PRPF31 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PRPF31 (Q8WWY3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTAS | Uniprot ID | Q8WWY3 |
Uniprot Id
Q8WWY3
Target Species
Human
Target Name
PRPF31
Target Full Name
U4/U6 small nuclear ribonucleoprotein Prp31
Target Function
Involved in pre-mRNA splicing as component of the spliceosome. Required for the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome.
Target Involvement
Retinitis pigmentosa 11 (RP11)
Target Subcellular Location
Nucleus. Nucleus speckle. Nucleus, Cajal body.
Target Protein Families
PRP31 family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
DKFZp566J153; hPrp 31; hPrp31; NY BR 99; Pre mRNA processing factor 31; Pre mRNA processing factor 31 homolog (yeast); Pre mRNA processing factor 31 homolog; Pre-mRNA-processing factor 31; Precursor mRNA-processing factor 31; S. cerevisiae; homolog of; Protein 61K; PRP 31; PRP31; PRP31 pre mRNA processing factor 31 homolog (yeast); PRP31 pre mRNA processing factor 31 homolog; PRP31_HUMAN; PRPF 31; prpf31; RP 11; RP11; Serologically defined breast cancer antigen NY BR 99; Serologically defined breast cancer antigen NY-BR-99; SNRNP61; U4/U6 small nuclear ribonucleoprotein Prp31; U4/U6 snRNP 61 kDa protein
Target Background
This gene encodes a component of the spliceosome complex and is one of several retinitis pigmentosa-causing genes. When the gene product is added to the spliceosome complex, activation occurs.
Notification