-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Pumilio 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pumilio 2 (Q8TB72) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Pumilio 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pumilio 2 (Q8TB72) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14262A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Pumilio 2 |
| Target Synonyms | PUMH2; PUML2; Pumilio 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pumilio 2 (Q8TB72). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGASHHSMSQPIMVQRRSGQGFHGNSEVNAILSPRSESGGLGVSMVEYVLS | Uniprot ID | Q8TB72 |
Uniprot Id
Q8TB72
Target Species
Human
Target Name
PUM2
Target Full Name
Pumilio homolog 2
Target Function
Sequence-specific RNA-binding protein that acts as a post-transcriptional repressor by binding the 3'-UTR of mRNA targets. Binds to an RNA consensus sequence, the Pumilio Response Element (PRE), 5'-UGUANAUA-3', that is related to the Nanos Response Element (NRE) (, PubMed:21397187). Mediates post-transcriptional repression of transcripts via different mechanisms: acts via direct recruitment of the CCR4-POP2-NOT deadenylase leading to translational inhibition and mRNA degradation. Also mediates deadenylation-independent repression by promoting accessibility of miRNAs. Acts as a post-transcriptional repressor of E2F3 mRNAs by binding to its 3'-UTR and facilitating miRNA regulation. Plays a role in cytoplasmic sensing of viral infection. Represses a program of genes necessary to maintain genomic stability such as key mitotic, DNA repair and DNA replication factors. Its ability to repress those target mRNAs is regulated by the lncRNA NORAD (non-coding RNA activated by DNA damage) which, due to its high abundance and multitude of PUMILIO binding sites, is able to sequester a significant fraction of PUM1 and PUM2 in the cytoplasm. May regulate DCUN1D3 mRNA levels. May support proliferation and self-renewal of stem cells. Binds specifically to miRNA MIR199A precursor, with PUM1, regulates miRNA MIR199A expression at a postranscriptional level.
Target Subcellular Location
Cytoplasm. Cytoplasmic granule. Cytoplasm, perinuclear region.
Target Tissue Specificity
Expressed in male germ cells of adult testis (at protein level). Highly expressed in testis and ovary. Predominantly expressed in stem cells and germ cells. Expressed at lower level in brain, heart, kidney, liver, muscle, placenta, intestine and stomach E
Target Synonyms
FLJ36528; KIAA0235; MGC138251; MGC138253; PUM 2; PUM2; PUM2_HUMAN; PUMH 2; PUMH2; Pumilio (Drosphila) homolog 2; Pumilio homolog 2 (Drosophila); Pumilio homolog 2; Pumilio-2; Pumilio2; PUML2
Target Background
This gene encodes a protein that belongs to a family of RNA-binding proteins. The encoded protein functions as a translational repressor during embryonic development and cell differentiation. This protein is also thought to be a positive regulator of cell proliferation in adipose-derived stem cells. Alternate splicing results in multiple transcript variants.
Notification