-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RalA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-206 of human RalA (NP_005393.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RalA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-206 of human RalA (NP_005393.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15356A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RALA |
| Target Synonyms | RAL; HINCONS; RALA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | COS-7, HUVEC | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-206 of human RalA (NP_005393.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL | Uniprot ID | P11233 |
Uniprot Id
P11233
Target Species
Human
Target Name
RALA
Target Full Name
Ras-related protein Ral-A
Target Function
Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling. Key regulator of LPAR1 signaling and competes with GRK2 for binding to LPAR1 thus affecting the signaling properties of the receptor. Required for anchorage-independent proliferation of transformed cells. During mitosis, supports the stabilization and elongation of the intracellular bridge between dividing cells. Cooperates with EXOC2 to recruit other components of the exocyst to the early midbody. During mitosis, also controls mitochondrial fission by recruiting to the mitochondrion RALBP1, which mediates the phosphorylation and activation of DNM1L by the mitotic kinase cyclin B-CDK1.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cleavage furrow. Midbody, Midbody ring. Mitochondrion.
Target Protein Families
Small GTPase superfamily, Ras family
Target Synonyms
MGC48949; Ral a; Ral A protein; RAL; RALA; RALA_HUMAN; Ras family small GTP binding protein RALA; RAS like protein A; Ras related protein RalA; Ras-related protein Ral-A; v ral simian leukemia viral oncogene homolog A (ras related); v ral simian leukemia viral oncogene homolog A
Target Background
The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins.
Notification