-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBBP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBBP4 (NP_005601.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RBBP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBBP4 (NP_005601.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13794A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBBP4 |
| Target Synonyms | NURF55; RBAP48; lin-53; RBBP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Mouse lung, Mouse spleen, Rat lung, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBBP4 (NP_005601.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDS | Uniprot ID | Q09028 |
Uniprot Id
Q09028
Target Species
Human
Target Name
RBBP4
Target Full Name
Histone-binding protein RBBP4
Target Function
Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; the PRC2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex.
Target Subcellular Location
Nucleus.
Target Protein Families
WD repeat RBAP46/RBAP48/MSI1 family
Target Synonyms
CAF I p48; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; Chromatin assembly factor 1 subunit C; Chromatin assembly factor I p48 subunit; Chromatin assembly factor/CAF 1 p48 subunit; Histone-binding protein RBBP4; MSI1 protein homolog; Nucleosome-remodeling factor subunit RBAP48; NURF55; RB binding protein 4 chromatin remodeling factor; RbAp 48; RBAP48 ; RBBP-4; RBBP4; RBBP4_HUMAN; Retinoblastoma binding protein 4; Retinoblastoma binding protein p48; Retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48
Target Background
This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.
Notification