Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Secretagogin (SCGN) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 177-276 of human Secretagogin (Secretagogin (SCGN)) (O76038) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Secretagogin (SCGN) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 177-276 of human Secretagogin (Secretagogin (SCGN)) (O76038) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14366A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Secretagogin (SCGN) |
| Target Synonyms | SEGN; CALBL; SECRET; setagin; DJ501N12.8; Secretagogin (SCGN) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat pancreas | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 177-276 of human Secretagogin (Secretagogin (SCGN)) (O76038). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP | Uniprot ID | O76038 |
Uniprot Id
O76038
Target Species
Human
Target Name
SCGN
Target Full Name
Secretagogin
Target Subcellular Location
Cytoplasm. Secreted. Cytoplasmic vesicle, secretory vesicle membrane; Peripheral membrane protein; Cytoplasmic side.
Target Tissue Specificity
Expressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the expression is restric
Target Synonyms
Calbindin like; CALBL ; DJ501N12.8; OTTHUMP00000016124; Scgn; SECRET; Secretagogin; Secretagogin EF hand calcium binding protein ; SEGN ; SEGN_HUMAN; Setagin
Target Background
The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
