-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRSF1/SF2/ASF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRSF1/SF2/ASF (NP_008855.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SRSF1/SF2/ASF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRSF1/SF2/ASF (NP_008855.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16581A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRSF1/SF2/ASF |
| Target Synonyms | ASF; SF2; SFRS1; SF2p33; SRp30a; SRSF1/SF2/ASF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, MCF7, Mouse thymus, Rat thymus, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRSF1/SF2/ASF (NP_008855.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSP | Uniprot ID | Q07955 |
Uniprot Id
Q07955
Target Species
Human
Target Name
SRSF1
Target Full Name
Serine/arginine-rich splicing factor 1
Target Function
Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences, either the octamer, 5'-RGAAGAAC-3' (r=A or G) or the decamers, AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro, the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway.
Target Subcellular Location
Cytoplasm. Nucleus speckle.
Target Protein Families
Splicing factor SR family
Target Research Area
Transcription
Target Synonyms
Alternative splicing factor 1; Alternative-splicing factor 1; arginine/serine-rich 1; ASF 1; ASF; ASF-1; ASF1; FLJ53078; MGC5228; P33 subunit; Pre mRNA splicing factor SF2 P33 subunit; pre-mRNA-splicing factor SF2; Serine/arginine-rich splicing factor 1; SF2; SF2P33; SFRS1; Splicing factor 2 alternate splicing factor; Splicing factor 2; Splicing factor; Splicing factor arginine/serine rich 1; SR Splicing factor 1; SRp30a; srsf1; SRSF1_HUMAN
Target Background
This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13.
Notification