-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUMO2/3 was raised in Rabbit using the recombinant protein of human SUMO2/3 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SUMO2/3 was raised in Rabbit using the recombinant protein of human SUMO2/3 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15024A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUMO2/3 |
| Target Synonyms | HSMT3; SMT3B; SUMO3; Smt3A; SMT3H2; SUMO2/3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, 293F, PC-12 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant protein of human SUMO2/3. | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY | Uniprot ID | P61956 |
Uniprot Id
P61956
Target Species
Human
Target Name
SUMO2
Target Full Name
Small ubiquitin-related modifier 2
Target Function
Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2, CBX4 or ZNF451. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX.
Target Subcellular Location
Nucleus. Nucleus, PML body.
Target Protein Families
Ubiquitin family, SUMO subfamily
Target Tissue Specificity
Broadly expressed.
Target Synonyms
HSMT 3; HSMT3; MGC117191; Sentrin 2; Sentrin-2; Sentrin2; Small ubiquitin like modifier 2; Small ubiquitin related modifier 2; Small ubiquitin-related modifier 2; SMT 3B; SMT3 homolog 2; SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3, yeast, homolog 2; Smt3A; SMT3B; SMT3H2; SUMO-2; SUMO-3; SUMO2; SUMO2_HUMAN; Sumo3; Ubiquitin like protein SMT3B; Ubiquitin-like protein SMT3A
Target Background
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Notification