-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 405-504 of human TAB1 (Q15750) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TAB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 405-504 of human TAB1 (Q15750) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14133A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAB1 |
| Target Synonyms | 3'-Tab1; MAP3K7IP1; TAB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 405-504 of human TAB1 (Q15750). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP | Uniprot ID | Q15750 |
Uniprot Id
Q15750
Target Species
Human
Target Name
TAB1
Target Full Name
TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
Target Function
May be an important signaling intermediate between TGFB receptors and MAP3K7/TAK1. May play an important role in mammalian embryogenesis.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
2310012M03Rik; 3'-Tab1; MAP3K7IP 1; MAP3K7IP1; MGC57664; Mitogen activated protein kinase kinase kinase 7 interacting protein 1; Mitogen-activated protein kinase kinase kinase 7-interacting protein 1; TAB 1; TAB1; TAB1_HUMAN; TAK1 binding protein 1; TAK1-binding protein 1; TGF beta activated kinase 1 binding protein 1; TGF-beta activated kinase 1/MAP3K7 binding protein 1; TGF-beta-activated kinase 1 and MAP3K7-binding protein 1; TGF-beta-activated kinase 1-binding protein 1; Transforming growth factor beta activated kinase binding protein 1
Target Background
The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Notification