Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Talin 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Talin 2 (Q9Y4G6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Talin 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Talin 2 (Q9Y4G6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16241A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Talin 2 |
| Target Synonyms | ILWEQ; TLN2; Talin-2; Talin 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Talin 2 (Q9Y4G6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNRTGKAEHGSV | Uniprot ID | Q9Y4G6 |
Uniprot Id
Q9Y4G6
Target Species
Human
Target Name
TLN2
Target Full Name
Talin-2
Target Function
As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity.
Target Subcellular Location
Cytoplasm. Cell junction, focal adhesion. Cell junction, synapse. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton.
Target Research Area
Signal Transduction
Target Synonyms
DKFZp451B1011; DKFZp686I0976; DKFZp686K0979; ILWEQ; KIAA0320; Talin-2; talin2; TLN 2; TLN2; TLN2_HUMAN
Target Background
This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. This protein has a different pattern of expression compared to talin 1 but, like talin 1, is thought to associate with unique transmembrane receptors to form novel linkages between extracellular matrices and the actin cytoskeleton.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
