Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Thioredoxin 2 (Trx2/TXN2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 67-166 of human TXN2 (Q99757) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Thioredoxin 2 (Trx2/TXN2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 67-166 of human TXN2 (Q99757) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16594A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Thioredoxin 2 (Trx2/TXN2) |
| Target Synonyms | TXN; MTRX; TRX2; MT-TRX; COXPD29; Thioredoxin 2 (Trx2/TXN2) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, HepG2, Jurkat, Mouse brain, Mouse liver, Mouse spleen, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 67-166 of human TXN2 (Q99757). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG | Uniprot ID | Q99757 |
Uniprot Id
Q99757
Target Species
Human
Target Name
TXN2
Target Full Name
Thioredoxin, mitochondrial
Target Function
Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity.
Target Involvement
Combined oxidative phosphorylation deficiency 29 (COXPD29)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Thioredoxin family
Target Tissue Specificity
Widely expressed in adult (at protein level) and fetal tissues.
Target Research Area
Signal Transduction
Target Synonyms
TXN2; TRX2; Thioredoxin; mitochondrial; MTRX; Mt-Trx; Thioredoxin-2
Target Background
This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
