-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Thromboxane synthase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thromboxane synthase (P24557) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Thromboxane synthase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thromboxane synthase (P24557) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13952A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Thromboxane synthase |
| Target Synonyms | TS; TXS; CYP5; THAS; TXAS; CYP5A1; GHOSAL; BDPLT14; Thromboxane synthase | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, Mouse lung, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thromboxane synthase (P24557). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVL | Uniprot ID | P24557 |
Uniprot Id
P24557
Target Species
Human
Target Name
TBXAS1
Target Full Name
Thromboxane-A synthase
Target Function
Catalyzes the conversion of prostaglandin H2 (PGH2) to thromboxane A2 (TXA2), a potent inducer of blood vessel constriction and platelet aggregation. Cleaves also PGH2 to 12-hydroxy-heptadecatrienoicacid (12-HHT) and malondialdehyde, which is known to act as a mediator of DNA damage. 12-HHT and malondialdehyde are formed stoichiometrically in the same amounts as TXA2. Additionally, displays dehydratase activity, toward (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate (15(S)-HPETE) producing 15-KETE and 15-HETE.
Target Involvement
Ghosal hematodiaphyseal dysplasia (GHDD)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Cytochrome P450 family
Target Tissue Specificity
Platelets, lung, kidney, spleen, macrophages and lung fibroblasts.
Target Synonyms
TBXAS1; CYP5; CYP5A1; TXAS; Thromboxane-A synthase; TXA synthase; TXS; Cytochrome P450 5A1; Hydroperoxy icosatetraenoate dehydratase
Target Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification