-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Tropomyosin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin 1 (P09493) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against Tropomyosin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin 1 (P09493) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-13982A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Tropomyosin 1 |
| Target Synonyms | CMH3; TMSA; CMD1Y; LVNC9; C15orf13; HEL-S-265; HTM-alpha; Tropomyosin 1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin 1 (P09493). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI | Uniprot ID | P09493 |
Uniprot Id
P09493
Target Species
Human
Target Name
TPM1
Target Full Name
Tropomyosin alpha-1 chain
Target Function
Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments.
Target Involvement
Cardiomyopathy, familial hypertrophic 3 (CMH3); Cardiomyopathy, dilated 1Y (CMD1Y); Left ventricular non-compaction 9 (LVNC9)
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Tropomyosin family
Target Tissue Specificity
Detected in primary breast cancer tissues but undetectable in normal breast tissues in Sudanese patients. Isoform 1 is expressed in adult and fetal skeletal muscle and cardiac tissues, with higher expression levels in the cardiac tissues. Isoform 10 is ex
Target Synonyms
AA986836; AI854628; Alpha tropomyosin ; alpha-TM; Alpha-tropomyosin; C15orf13; cardiomyopathy; hypertrophic 3; CMD1Y; CMH3; HTM alpha; HTM-alpha; OTTHUMP00000163688; sarcomeric tropomyosin kappa; TM2; Tmpa; TMSA; Tpm-1; TPM1; TPM1_HUMAN; tropomyosin 1 (alpha); tropomyosin 1 (alpha) isoform 1; tropomyosin 1 (alpha) isoform 2; tropomyosin 1 (alpha) isoform 3; tropomyosin 1 (alpha) isoform 4; tropomyosin 1 (alpha) isoform 5; tropomyosin 1 (alpha) isoform 6; tropomyosin 1 (alpha) isoform 7; Tropomyosin 1; Tropomyosin alpha 1 chain; Tropomyosin alpha-1 chain; Tropomyosin; skeletal muscle alpha; Tropomyosin-1
Target Background
This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy and dilated cardiomyopathy 1Y.
Notification