-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ube2L3 / UBCH7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 55-154 of human Ube2L3 / UBCH7 (P68036) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Ube2L3 / UBCH7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 55-154 of human Ube2L3 / UBCH7 (P68036) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13483A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ube2L3 / UBCH7 |
| Target Synonyms | E2-F1; L-UBC; UBCH7; UbcM4; Ube2L3 / UBCH7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, K-562, Mouse brain, Mouse testis, Rat lung, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 55-154 of human Ube2L3 / UBCH7 (P68036). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | INFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD | Uniprot ID | P68036 |
Uniprot Id
P68036
Target Species
Human
Target Name
UBE2L3
Target Full Name
Ubiquitin-conjugating enzyme E2 L3
Target Function
Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PRKN and ARIH1, that function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-lived and abnormal proteins. Down-regulated during the S-phase it is involved in progression through the cell cycle. Regulates nuclear hormone receptors transcriptional activity. May play a role in myelopoiesis.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Ubiquitous, with highest expression in testis.
Target Synonyms
E2 F1; L UBC; L-UBC; UB2L3_HUMAN; UBCE7; UbcH7; UbcM4; Ube2l3; Ubiquitin carrier protein L3; Ubiquitin conjugating enzyme E2 L3; Ubiquitin protein ligase L3; Ubiquitin-conjugating enzyme E2 L3; Ubiquitin-conjugating enzyme E2-F1; Ubiquitin-protein ligase L3
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene.
Notification