Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UFC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of Human UFC1 (NP_057490.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UFC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of Human UFC1 (NP_057490.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using UFC1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20s.
| Cat.No | ADA-14598A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UFC1 |
| Target Synonyms | NEDSG; HSPC155; UFC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7, Mouse pancreas, Rat pancreas, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of Human UFC1 (NP_057490.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVP | Uniprot ID | Q9Y3C8 |
Uniprot Id
Q9Y3C8
Target Species
Human
Target Name
UFC1
Target Full Name
Ubiquitin-fold modifier-conjugating enzyme 1
Target Function
E1-like enzyme which specifically catalyzes the second step in ufmylation. Accepts the ubiquitin-like modifier UFM1 from the E1 enzyme UBA5 and forms an intermediate with UFM1 via a thioester linkage. Ufmylation is involved in reticulophagy (also called ER-phagy) induced in response to endoplasmic reticulum stress.
Target Protein Families
Ubiquitin-conjugating enzyme family, UFC1 subfamily
Target Synonyms
CGI-126; HSPC155; Ubiquitin fold modifier conjugating enzyme 1; Ubiquitin-fold modifier-conjugating enzyme 1; UFC1; UFC1_HUMAN; Ufm1 conjugating enzyme 1; Ufm1-conjugating enzyme 1
Target Background
UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1 (UFM1; MIM 610553) (Komatsu et al., 2004 [PubMed 15071506]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
