-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZIC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ZIC1 (Q15915) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZIC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ZIC1 (Q15915) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14341A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZIC1 |
| Target Synonyms | ZIC; CRS6; BAIDCS; ZNF201; ZIC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ZIC1 (Q15915). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFNSTRDF | Uniprot ID | Q15915 |
Uniprot Id
Q15915
Target Species
Human
Target Name
ZIC1
Target Full Name
Zinc finger protein ZIC 1
Target Function
Acts as a transcriptional activator. Involved in neurogenesis. Plays important roles in the early stage of organogenesis of the CNS, as well as during dorsal spinal cord development and maturation of the cerebellum. Involved in the spatial distribution of mossy fiber (MF) neurons within the pontine gray nucleus (PGN). Plays a role in the regulation of MF axon pathway choice. Promotes MF migration towards ipsilaterally-located cerebellar territories. May have a role in shear flow mechanotransduction in osteocytes. Retains nuclear GLI1 and GLI3 in the cytoplasm. Binds to the minimal GLI-consensus sequence 5'-TGGGTGGTC-3'.
Target Involvement
Craniosynostosis 6 (CRS6)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
GLI C2H2-type zinc-finger protein family
Target Tissue Specificity
CNS. A high level expression is seen in the cerebellum. Detected in the nuclei of the cerebellar granule cell lineage from the progenitor cells of the external germinal layer to the postmigrated cells of the internal granular layer. Detected in medullobla
Target Synonyms
Odd paired homolog Drosophila; Zic 1; ZIC; Zic family member 1 (odd-paired Drosophila homolog); Zic family member 1; Zic protein member 1; zic1; ZIC1_HUMAN; Zinc finger protein 201; Zinc finger protein of the cerebellum 1; Zinc finger protein ZIC 1; Zinc finger protein ZIC1; ZNF 201; ZNF201
Target Background
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene.
Notification