Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF207 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 295-387 of human ZNF207 (NP_003448.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against ZNF207 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 295-387 of human ZNF207 (NP_003448.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of ZNF207 in paraffin-embedded human breast cancer using ZNF207 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-15529A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF207 |
| Target Synonyms | BuGZ; hBuGZ; ZNF207 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 295-387 of human ZNF207 (NP_003448.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLP | Uniprot ID | O43670 |
Uniprot Id
O43670
Target Species
Human
Target Name
ZNF207
Target Full Name
BUB3-interacting and GLEBS motif-containing protein ZNF207
Target Function
Kinetochore- and microtubule-binding protein that plays a key role in spindle assembly. ZNF207/BuGZ is mainly composed of disordered low-complexity regions and undergoes phase transition or coacervation to form temperature-dependent liquid droplets. Coacervation promotes microtubule bundling and concentrates tubulin, promoting microtubule polymerization and assembly of spindle and spindle matrix by concentrating its building blocks. Also acts as a regulator of mitotic chromosome alignment by mediating the stability and kinetochore loading of BUB3. Mechanisms by which BUB3 is protected are unclear: according to a first report, ZNF207/BuGZ may act by blocking ubiquitination and proteasomal degradation of BUB3. According to another report, the stabilization is independent of the proteasome.
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Zinc finger protein 207; ZN207_HUMAN; ZNF 207; ZNF207
Target Background
Enables microtubule binding activity. Involved in several processes, including mitotic nuclear division; mitotic spindle assembly checkpoint signaling; and protein stabilization. Located in kinetochore; nuclear lumen; and spindle matrix.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
