Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Aquaporin-1 (AQP1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-269 of human Aquaporin-1 (AQP1) (NP_932766.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Aquaporin-1 (AQP1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-269 of human Aquaporin-1 (AQP1) (NP_932766.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12474A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Aquaporin-1 (AQP1) |
| Target Synonyms | CO; CHIP28; AQP-CHIP; Aquaporin-1 (AQP1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse liver, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-269 of human Aquaporin-1 (AQP1) (NP_932766.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK | Uniprot ID | P29972 |
Uniprot Id
P29972
Target Species
Human
Target Name
AQP1
Target Full Name
Aquaporin-1
Target Function
Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
MIP/aquaporin (TC 1.A.8) family
Target Tissue Specificity
Detected in erythrocytes (at protein level). Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver.
Target Research Area
Transport
Target Synonyms
AQP1; CHIP28; Aquaporin-1; AQP-1; Aquaporin-CHIP; Urine water channel; Water channel protein for red blood cells and kidney proximal tubule
Target Background
This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
