Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Osteocalcin (BGLAP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Osteocalcin (BGLAP) (NP_954642.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Osteocalcin (BGLAP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Osteocalcin (BGLAP) (NP_954642.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13014A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Osteocalcin (BGLAP) |
| Target Synonyms | OC; BGP; OCN; Osteocalcin (BGLAP) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Osteocalcin (BGLAP) (NP_954642.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV | Uniprot ID | P02818 |
Uniprot Id
P02818
Target Species
Human
Target Name
BGLAP
Target Full Name
Osteocalcin
Target Function
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Target Subcellular Location
Secreted.
Target Protein Families
Osteocalcin/matrix Gla protein family
Target Synonyms
OC; BGP; OCN; Osteocalcin (BGLAP)
Target Background
This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
