-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HS3ST3A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-140 of human HS3ST3A1 (NP_006033.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HS3ST3A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-140 of human HS3ST3A1 (NP_006033.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00270A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HS3ST3A1 |
| Target Synonyms | 3OST3A1; 3-OST-3A; HS3ST3A1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 44-140 of human HS3ST3A1 (NP_006033.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERCQTLSGPVVGLSGGGEEAGAPGGGVLAGGPRELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEESPGLSGGPGGSGAGSTVAEAPPGT | Uniprot ID | Q9Y663 |
Uniprot Id
Q9Y663
Target Species
Human
Target Name
HS3ST3A1
Target Full Name
Heparan sulfate glucosamine 3-O-sulfotransferase 3A1
Target Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N-unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate. Catalyzes the O-sulfation of glucosamine in IdoUA2S-GlcNS and also in IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Sulfotransferase 1 family
Target Tissue Specificity
Ubiquitous. Most abundant in heart and placenta, followed by liver and kidney.
Target Synonyms
HS3ST3A1; 3OST3A1; HS3ST3A; UNQ2551/PRO6180Heparan sulfate glucosamine 3-O-sulfotransferase 3A1; EC 2.8.2.30; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1; 3-OST-3A; Heparan sulfate 3-O-sulfotransferase 3A1; h3-OST-3A
Target Background
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.
Notification