Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSD17B2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human HSD17B2 (NP_002144.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HSD17B2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human HSD17B2 (NP_002144.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00537A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSD17B2 |
| Target Synonyms | HSD17; SDR9C2; EDH17B2; HSD17B2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human HSD17B2 (NP_002144.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVT | Uniprot ID | P37059 |
Uniprot Id
P37059
Target Species
Human
Target Name
HSD17B2
Target Full Name
17-beta-hydroxysteroid dehydrogenase type 2
Target Function
Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Target Tissue Specificity
Expressed in placenta.
Target Synonyms
HSD17B2; EDH17B2; SDR9C2; 17-beta-hydroxysteroid dehydrogenase type 2; 17-beta-HSD 2; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; E2DH; Estradiol 17-beta-dehydrogenase 2; Microsomal 17-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 2; Testosterone 17-beta-dehydrogenase
Target Background
Enables estradiol 17-beta-dehydrogenase activity and testosterone dehydrogenase (NAD+) activity. Involved in response to retinoic acid. Predicted to be located in endoplasmic reticulum membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
