-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CKAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 335-460 of human CKAP2 (NP_001273616.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CKAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 335-460 of human CKAP2 (NP_001273616.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00943A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CKAP2 |
| Target Synonyms | LB1; TMAP; se20-10; CKAP2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 335-460 of human CKAP2 (NP_001273616.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLV | Uniprot ID | Q8WWK9 |
Uniprot Id
Q8WWK9
Target Species
Human
Target Name
CKAP2
Target Full Name
Cytoskeleton-associated protein 2
Target Function
Possesses microtubule stabilizing properties. Involved in regulating aneuploidy, cell cycling, and cell death in a p53/TP53-dependent manner.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, spindle. Cytoplasm, cytoskeleton, spindle pole. Note=Contrary to the ectopically expressed protein, endogenous CKAP2 does not colocalize with microtubules in G1, S and early G2. At late G2 and prophase after separation of duplicated centrosomes, colocalizes with gamma-tubulin and centrosome-proximal microtubules. From prometaphase through anaphase B, colocalizes with mitotic spindle poles and spindle microtubules. During cytokinesis, absent from midbody microtubules.
Target Protein Families
CKAP2 family
Target Tissue Specificity
Abundant in testis, thymus, and in tumor derived cell lines, while barely detectable in liver, prostate, and kidney.
Target Synonyms
AI461656; AW228814; CKAP 2; Ckap2; CKAP2_HUMAN; CTCL tumor antigen se20 10; CTCL tumor antigen se20-10; Cytoskeleton associated protein 2; Cytoskeleton-associated protein 2; DKFZp686L1238; FLJ10749; LB1; se20 10; TMAP; Tumor and microtubule associated protein; Tumor associated microtubule associated protein; Tumor- and microtubule-associated protein
Target Background
This gene encodes a cytoskeleton-associated protein that stabalizes microtubules and plays a role in the regulation of cell division. The encoded protein is itself regulated through phosphorylation at multiple serine and threonine residues. There is a pseudogene of this gene on chromosome 14. Alternative splicing results in multiple transcript variations.
Notification