-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-270 of human KIN (NP_036443.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-270 of human KIN (NP_036443.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06993A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIN |
| Target Synonyms | BTCD; Rts2; KIN17; KIN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BxPC-3, Mouse testis, PC-3, Rat testis, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-270 of human KIN (NP_036443.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSSGATSSKSSTLGPSALKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEE | Uniprot ID | O60870 |
Uniprot Id
O60870
Target Species
Human
Target Name
KIN
Target Full Name
DNA/RNA-binding protein KIN17
Target Function
Involved in DNA replication and the cellular response to DNA damage. May participate in DNA replication factories and create a bridge between DNA replication and repair mediated by high molecular weight complexes. May play a role in illegitimate recombination and regulation of gene expression. May participate in mRNA processing. Binds, in vitro, to double-stranded DNA. Also shown to bind preferentially to curved DNA in vitro and in vivo. Binds via its C-terminal domain to RNA in vitro.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
KIN17 family
Target Tissue Specificity
Ubiquitously expressed in all tissues examined, with highest levels in skeletal muscle, heart and testis. Differentially expressed in non-tumorigenic and tumorigenic cell lines. Highly expressed in proliferating epithelial keratinocyte cells in vitro (at
Target Synonyms
KIN; BTCD; KIN17DNA/RNA-binding protein KIN17; Binding to curved DNA; KIN; antigenic determinant of recA protein homolog
Target Background
The protein encoded by this gene is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by this human ortholog. Alternative splicing of this gene results in multiple transcript variants.
Notification