Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Histone H1t was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 110-209 of mouse Histone H1t (NP_034507.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Histone H1t was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 110-209 of mouse Histone H1t (NP_034507.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07340A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Histone H1t |
| Target Synonyms | H1t; H1-6; H1.6; H1ft; Hist1h1t; Histone H1t | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 110-209 of mouse Histone H1t (NP_034507.2). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | LSKKAASGNDKGKGKKSASAKAKKMGLPRASRSPKSSKTKAVKKPKATPTKASGSGRKTKGAKGVQQRKSPAKARAANPNSGKAKMVMQKTDLRKAAGRK | Uniprot ID | Q07133 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
