-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eNOS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1035-1110 of human eNOS (NP_000594.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against eNOS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1035-1110 of human eNOS (NP_000594.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-07843A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | eNOS |
| Target Synonyms | eNOS; ECNOS | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1035-1110 of human eNOS (NP_000594.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEVHRVLCLERGH | Uniprot ID | P29474 |
Uniprot Id
P29474
Target Species
Human
Target Name
NOS3
Target Full Name
Nitric oxide synthase 3
Target Function
Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.; Lacks eNOS activity, dominant-negative form that may down-regulate eNOS activity by forming heterodimers with isoform 1.
Target Involvement
Variation Asp-298 in NOS3 may be associated with susceptibility to coronary spasm.
Target Subcellular Location
Cell membrane. Membrane, caveola. Cytoplasm, cytoskeleton. Golgi apparatus. Note=Specifically associates with actin cytoskeleton in the G2 phase of the cell cycle; which is favored by interaction with NOSIP and results in a reduced enzymatic activity.
Target Protein Families
NOS family
Target Tissue Specificity
Platelets, placenta, liver and kidney.
Target Synonyms
cNOS; Constitutive NOS; EC NOS; EC-NOS; ecNOS; Endothelial nitric oxidase synthase ; Endothelial nitric oxide synthase ; Endothelial nitric oxide synthase 3; Endothelial NOS; eNOS; Nitric oxide synthase 3 (endothelial cell); Nitric oxide synthase 3; Nitric oxide synthase 3 endothelial cell; Nitric oxide synthase endothelial; Nitric oxide synthase; endothelial; NOS 3; NOS III; NOS type III; NOS3; NOS3_HUMAN; NOSIII
Target Background
Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Notification