-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCB11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human ABCB11 (NP_003733.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against ABCB11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human ABCB11 (NP_003733.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-11923A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCB11 |
| Target Synonyms | BSEP; PGY4; SPGP; ABC16; BRIC2; PFIC2; PFIC-2; ABCB11 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human ABCB11 (NP_003733.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RFFQLLDRQPPISVYNTAGEKWDNFQGKIDFVDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMIDGHDSKKVNVQ | Uniprot ID | O95342 |
Uniprot Id
O95342
Target Species
Human
Target Name
ABCB11
Target Full Name
Bile salt export pump
Target Function
Catalyzes the transport of the major hydrophobic bile salts, such as taurine and glycine-conjugated cholic acid across the canalicular membrane of hepatocytes in an ATP-dependent manner, therefore participates in hepatic bile acid homeostasis and consequently to lipid homeostasis through regulation of biliary lipid secretion in a bile salts dependent manner. Transports taurine-conjugated bile salts more rapidly than glycine-conjugated bile salts. Also transports non-bile acid compounds, such as pravastatin and fexofenadine in an ATP-dependent manner and may be involved in their biliary excretion.
Target Involvement
Cholestasis, progressive familial intrahepatic, 2 (PFIC2); Cholestasis, benign recurrent intrahepatic, 2 (BRIC2)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Endosome. Cell membrane; Multi-pass membrane protein.
Target Protein Families
ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
Target Tissue Specificity
Expressed predominantly, if not exclusively in the liver, where it was further localized to the canalicular microvilli and to subcanalicular vesicles of the hepatocytes by in situ.
Target Research Area
Cancer
Target Synonyms
ABC member 16; MDR/TAP subfamily; ABC16; ABCB1; Abcb11; ABCBB_HUMAN; ATP binding cassette sub family B (MDR/TAP) member 11; ATP binding cassette sub family B member 11; ATP-binding cassette sub-family B member 11; Bile salt export pump; BRIC2; Bsep; PFIC 2; PFIC2; PGY4; progressive familial intrahepatic cholestasis 2; Sister of P glycoprotein; Spgp
Target Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is the major canalicular bile salt export pump in man. Mutations in this gene cause a form of progressive familial intrahepatic cholestases which are a group of inherited disorders with severe cholestatic liver disease from early infancy.
Notification