Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACOX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ACOX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11322A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACOX3 |
| Target Synonyms | ACOX3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSP | Uniprot ID | O15254 |
Uniprot Id
O15254
Target Species
Human
Target Name
ACOX3
Target Full Name
Peroxisomal acyl-coenzyme A oxidase 3
Target Function
Oxidizes the CoA-esters of 2-methyl-branched fatty acids.
Target Subcellular Location
Peroxisome.
Target Protein Families
Acyl-CoA oxidase family
Target Synonyms
ACOX3; BRCOX; PRCOXPeroxisomal acyl-coenzyme A oxidase 3; EC 1.3.3.6; Branched-chain acyl-CoA oxidase; BRCACox; Pristanoyl-CoA oxidase
Target Background
Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
