-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bak was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bak (NP_001179.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Bak was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bak (NP_001179.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13542A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Bak |
| Target Synonyms | BAK; CDN1; BCL2L7; BAK-LIKE; ak | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bak (NP_001179.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL | Uniprot ID | Q16611 |
Uniprot Id
Q16611
Target Species
Human
Target Name
BAK1
Target Full Name
Bcl-2 homologous antagonist/killer
Target Function
Plays a role in the mitochondrial apoptosic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytosol, including cytochrome c, promoting the activation of caspase 9 which in turn processes and activates the effector caspases.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.
Target Protein Families
Bcl-2 family
Target Tissue Specificity
Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.
Target Synonyms
BAK1; BAK; BCL2L7; CDN1; Bcl-2 homologous antagonist/killer; Apoptosis regulator BAK; Bcl-2-like protein 7; Bcl2-L-7
Target Background
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
Notification