-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD70 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 47-126 of human CD70 (NP_001243.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD70 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 47-126 of human CD70 (NP_001243.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04503A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD70 |
| Target Synonyms | CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A; CD70 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus, Raji, Rat spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 47-126 of human CD70 (NP_001243.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPT | Uniprot ID | P32970 |
Uniprot Id
P32970
Target Species
Human
Target Name
CD70
Target Full Name
CD70 antigen
Target Function
Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Tumor necrosis factor family
Target Research Area
Cancer
Target Synonyms
CD 27L; CD 70; CD27 L; CD27 LG; CD27 ligand; CD27-L; CD27L; CD27LG; CD70; CD70 antigen; CD70 molecule; CD70_HUMAN; Ki 24 antigen; Ki24 antigen; Surface antigen CD70; TNFSF 7 ; TNFSF7; Tumor necrosis factor (ligand) superfamily, member 7; Tumor necrosis factor ligand superfamily member 7
Target Background
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
Notification