Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CDK20 (Q8IZL9) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against CDK20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CDK20 (Q8IZL9) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded rat spleen using CDK20 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-04289A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK20 |
| Target Synonyms | P42; CCRK; CDCH; PNQALRE; CDK20 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CDK20 (Q8IZL9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSEL | Uniprot ID | Q8IZL9 |
Uniprot Id
Q8IZL9
Target Species
Human
Target Name
CDK20
Target Full Name
Cyclin-dependent kinase 20
Target Function
Required for high-level Shh responses in the developing neural tube. Together with TBC1D32, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in response to SHH signaling. Involved in cell growth. Activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue 'Thr-160'.
Target Subcellular Location
Nucleus. Cytoplasm. Cell projection, cilium.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Target Synonyms
CAK kinase p42; CAK-kinase p42; CCRK; CDCH; CDK activating kinase p42; CDK-activating kinase p42; cdk20; CDK20_HUMAN; Cell cycle related kinase ; Cell cycle-related kinase; Cell division protein kinase 20; Cyclin dependent protein kinase H; Cyclin kinase activating kinase p42; Cyclin-dependent kinase 20; Cyclin-dependent protein kinase H; Cyclin-kinase-activating kinase p42; p42; PNQALRE
Target Background
The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
