Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK5R2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human CDK5R2 (NP_003927.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDK5R2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human CDK5R2 (NP_003927.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06950A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK5R2 |
| Target Synonyms | P39; NCK5AI; p39nck5ai; CDK5R2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human CDK5R2 (NP_003927.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLR | Uniprot ID | Q13319 |
Uniprot Id
Q13319
Target Species
Human
Target Name
CDK5R2
Target Full Name
Cyclin-dependent kinase 5 activator 2
Target Function
Activator of CDK5/TPKII.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Cyclin-dependent kinase 5 activator family
Target Tissue Specificity
Brain and neuron specific.
Target Synonyms
CD5R2_HUMAN; CDK5 activator 2; Cdk5r2; Cyclin dependent kinase 5 activator 2; Cyclin dependent kinase 5 activator isoform p39i; Cyclin dependent kinase 5 regulatory subunit 2; Cyclin-dependent kinase 5 activator 2; Cyclin-dependent kinase 5 regulatory subunit 2; NCK5AI; Neuronal CDK5 activator isoform; p39; P39I; p39nck5ai
Target Background
The protein encoded by this gene is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
