Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHRAC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human CHRAC1 (NP_059140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHRAC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human CHRAC1 (NP_059140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16486A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHRAC1 |
| Target Synonyms | YCL1; CHARC1; CHARC15; CHRAC-1; CHRAC15; CHRAC-15; C1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human CHRAC1 (NP_059140.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS | Uniprot ID | Q9NRG0 |
Uniprot Id
Q9NRG0
Target Species
Human
Target Name
CHRAC1
Target Full Name
Chromatin accessibility complex protein 1
Target Function
Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1. Does not enhance nucleosome sliding activity of the ACF-5 ISWI chromatin remodeling complex.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
CHARC1; CHARC15; CHRAC-1; CHRAC-15; Chrac1; CHRAC15; CHRC1_HUMAN; Chromatin accessibility complex 1; Chromatin accessibility complex 15 kDa protein; Chromatin accessibility complex protein 1; DNA polymerase epsilon subunit p15; histone-fold protein CHRAC15; HuCHRAC15; YCL1
Target Background
CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
