Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human COA3 (NP_001035521.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human COA3 (NP_001035521.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05555A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COA3 |
| Target Synonyms | COX25; hCOA3; CCDC56; HSPC009; MC4DN14; MITRAC12; COA3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human COA3 (NP_001035521.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS | Uniprot ID | Q9Y2R0 |
Uniprot Id
Q9Y2R0
Target Species
Human
Target Name
COA3
Target Full Name
Cytochrome c oxidase assembly factor 3 homolog, mitochondrial
Target Function
Core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for efficient translation of MT-CO1 and mitochondrial respiratory chain complex IV assembly.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
COA3 family
Target Synonyms
COA3; CCDC56; MITRAC12; HSPC009; Cytochrome c oxidase assembly factor 3 homolog, mitochondrial; Coiled-coil domain-containing protein 56; Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa
Target Background
This gene encodes a member of the cytochrome c oxidase assembly factor family. Studies of a related gene in fly suggest that the encoded protein is localized to mitochondria and is essential for cytochrome c oxidase function.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
