-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Collagen III alpha 1/COL3A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1201-1301 of human Collagen III alpha 1/COL3A1 (NP_000081.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Collagen III alpha 1/COL3A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1201-1301 of human Collagen III alpha 1/COL3A1 (NP_000081.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13054A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Collagen III alpha 1/COL3A1 |
| Target Synonyms | EDS4A; EDSVASC; PMGEDSV; Collagen III alpha 1/COL3A1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1201-1301 of human Collagen III alpha 1/COL3A1 (NP_000081.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGET | Uniprot ID | P02461 |
Uniprot Id
P02461
Target Species
Human
Target Name
COL3A1
Target Full Name
Collagen alpha-1(III) chain
Target Function
Collagen type III occurs in most soft connective tissues along with type I collagen. Involved in regulation of cortical development. Is the major ligand of ADGRG1 in the developing brain and binding to ADGRG1 inhibits neuronal migration and activates the RhoA pathway by coupling ADGRG1 to GNA13 and possibly GNA12.
Target Involvement
Ehlers-Danlos syndrome 3 (EDS3); Ehlers-Danlos syndrome 4 (EDS4)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Fibrillar collagen family
Target Synonyms
EDS4A; EDSVASC; PMGEDSV; Collagen III alpha 1/COL3A1
Target Background
This gene encodes the pro-alpha1 chains of type III collagen, a fibrillar collagen that is found in extensible connective tissues such as skin, lung, uterus, intestine and the vascular system, frequently in association with type I collagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms.
Notification