-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CTNNA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 167-290 of human CTNNA2 (NP_001269526.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CTNNA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 167-290 of human CTNNA2 (NP_001269526.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10116A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CTNNA2 |
| Target Synonyms | CAPR; CTNR; CAP-R; CT114; CDCBM9; CTNNA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse testis, Neuro-2a, Rat liver, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 167-290 of human CTNNA2 (NP_001269526.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILD | Uniprot ID | P26232 |
Uniprot Id
P26232
Target Species
Human
Target Name
CTNNA2
Target Full Name
Catenin alpha-2
Target Function
May function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Required for proper regulation of cortical neuronal migration and neurite growth. It acts as negative regulator of Arp2/3 complex activity and Arp2/3-mediated actin polymerization. It thereby suppresses excessive actin branching which would impair neurite growth and stability. Regulates morphological plasticity of synapses and cerebellar and hippocampal lamination during development. Functions in the control of startle modulation.
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm. Cytoplasm, cytoskeleton. Cell junction, adherens junction. Cell projection, axon. Nucleus.
Target Protein Families
Vinculin/alpha-catenin family
Target Tissue Specificity
Expressed in neural tissues, with strongest expression in fetal and adult brain. Expressed in the developing cortical plate and marginal zone of 20-week-old human fetal brain.
Target Synonyms
Alpha catenin related protein; Alpha N catenin; Alpha N-catenin; Alpha-catenin-related protein; Cadherin associated protein related; Cancer/testis antigen 114; CAP R; CAPR; Catenin (cadherin associated protein) alpha 2; Catenin alpha 2; Catenin alpha-2; CT114; CTNA2_HUMAN; CTNN A2; CTNNA 2; CTNNA2; CTNR; DKFZp686H02198
Target Background
Enables actin filament binding activity. Involved in negative regulation of Arp2/3 complex-mediated actin nucleation; regulation of neuron migration; and regulation of neuron projection development. Located in cytoplasm. Implicated in complex cortical dysplasia with other brain malformations.
Notification