-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclin E2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 255-404 of human Cyclin E2 (NP_477097.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Cyclin E2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 255-404 of human Cyclin E2 (NP_477097.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08648A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclin E2 |
| Target Synonyms | CYCE2; Cyclin E2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 255-404 of human Cyclin E2 (NP_477097.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH | Uniprot ID | O96020 |
Uniprot Id
O96020
Target Species
Human
Target Name
CCNE2
Target Full Name
G1/S-specific cyclin-E2
Target Function
Essential for the control of the cell cycle at the late G1 and early S phase.
Target Subcellular Location
Nucleus.
Target Protein Families
Cyclin family, Cyclin E subfamily
Target Tissue Specificity
According to PubMed:9858585, highest levels of expression in adult testis, thymus and brain. Lower levels in placenta, spleen and colon. Consistently elevated levels in tumor-derived cells compared to non-transformed proliferating cells. According to PubM
Target Synonyms
CCNE2; G1/S-specific cyclin-E2
Target Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells.
Notification