-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCSTAMP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 401-470 of human DCSTAMP (NP_110415.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCSTAMP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 401-470 of human DCSTAMP (NP_110415.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10186A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCSTAMP |
| Target Synonyms | FIND; TM7SF4; hDC-STAMP; DCSTAMP | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 401-470 of human DCSTAMP (NP_110415.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KILVSASFYPSVERKRIQYLHAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS | Uniprot ID | Q9H295 |
Uniprot Id
Q9H295
Target Species
Human
Target Name
DCSTAMP
Target Full Name
Dendritic cell-specific transmembrane protein
Target Function
Probable cell surface receptor that plays several roles in cellular fusion, cell differentiation, bone and immune homeostasis. Plays a role in TNFSF11-mediated osteoclastogenesis. Cooperates with OCSTAMP in modulating cell-cell fusion in both osteoclasts and foreign body giant cells (FBGCs). Participates in osteoclast bone resorption. Involved in inducing the expression of tartrate-resistant acid phosphatase in osteoclast precursors. Plays a role in haematopoietic stem cell differentiation of bone marrow cells toward the myeloid lineage. Inhibits the development of neutrophilic granulocytes. Plays also a role in the regulation of dendritic cell (DC) antigen presentation activity by controlling phagocytic activity. Involved in the maintenance of immune self-tolerance and avoidance of autoimmune reactions.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endosome.
Target Tissue Specificity
Preferentially expressed by dendritic cells (DCs). Detected in both immature and mature DCs. Highly expressed in lymph nodes, lung, kidney and liver. Expressed at lower levels in pancreas, bone marrow, spleen, leukocytes, in freshly isolated peripheral bl
Target Synonyms
DCSTAMP; TM7SF4; Dendritic cell-specific transmembrane protein; DC-STAMP; hDC-STAMP; Dendrocyte-expressed seven transmembrane protein; IL-four-induced protein; FIND; Transmembrane 7 superfamily member 4
Target Background
This gene encodes a seven-pass transmembrane protein that is primarily expressed in dendritic cells. The encoded protein is involved in a range of immunological functions carried out by dendritic cells. This protein plays a role in osteoclastogenesis and myeloid differentiation. Alternate splicing results in multiple transcript variants.
Notification