Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human DDC (NP_000781.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DDC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human DDC (NP_000781.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08798A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDC |
| Target Synonyms | AADC; DDC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Mouse liver, Rat kidney, Rat liver, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human DDC (NP_000781.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKA | Uniprot ID | P20711 |
Uniprot Id
P20711
Target Species
Human
Target Name
DDC
Target Full Name
Aromatic-L-amino-acid decarboxylase
Target Function
Catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Target Involvement
Aromatic L-amino-acid decarboxylase deficiency (AADCD)
Target Protein Families
Group II decarboxylase family
Target Synonyms
AADC; Aromatic L Amino Acid Decarboxylase; Aromatic-L-amino-acid decarboxylase; DDC; DDC_HUMAN; DOPA decarboxylase (aromatic L-amino acid decarboxylase); DOPA decarboxylase
Target Background
The encoded protein catalyzes the decarboxylation of L-3, 4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Defects in this gene are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD). AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
