-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DHX30 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 336-501 of human DHX30(NP_619520.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DHX30 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 336-501 of human DHX30(NP_619520.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08377A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DHX30 |
| Target Synonyms | DDX30; RETCOR; NEDMIAL; DHX30 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-431(Low expression control), Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 336-501 of human DHX30(NP_619520.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RELGETQRRPCTIQVPEPILRKIETFLNHYPVESSWIAPELRLQSDDILPLGKDSGPLSDPITGKPYVPLLEAEEVRLSQSLLELWRRRGPVWQEAPQLPVDPHRDTILNAIEQHPVVVISGDTGCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQ | Uniprot ID | Q7L2E3 |
Uniprot Id
Q7L2E3
Target Species
Human
Target Name
DHX30
Target Full Name
ATP-dependent RNA helicase DHX30
Target Function
RNA-dependent helicase. Plays an important role in the assembly of the mitochondrial large ribosomal subunit. Required for optimal function of the zinc-finger antiviral protein ZC3HAV1. Associates with mitochondrial DNA. Involved in nervous system development and differentiation through its involvement in the up-regulation of a number of genes which are required for neurogenesis, including GSC, NCAM1, neurogenin, and NEUROD.
Target Subcellular Location
Cytoplasm. Mitochondrion. Mitochondrion matrix, mitochondrion nucleoid.
Target Protein Families
DEAD box helicase family, DEAH subfamily
Target Synonyms
DDX30; DEAH box protein 30; Dhx30; DHX30_HUMAN; FLJ11214; KIAA0890 ; Putative ATP-dependent RNA helicase DHX30; Ret CoR
Target Background
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The family member encoded by this gene is a mitochondrial nucleoid protein that associates with mitochondrial DNA. It has also been identified as a component of a transcriptional repressor complex that functions in retinal development, and it is required to optimize the function of the zinc-finger antiviral protein. Alternatively spliced transcript variants have been found for this gene.
Notification