Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNAJC24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-149 of human DNAJC24 (NP_859057.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNAJC24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-149 of human DNAJC24 (NP_859057.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04965A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNAJC24 |
| Target Synonyms | DPH4; JJJ3; ZCSL3; DNAJC24 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-149 of human DNAJC24 (NP_859057.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN | Uniprot ID | Q6P3W2 |
Uniprot Id
Q6P3W2
Target Species
Human
Target Name
DNAJC24
Target Full Name
DnaJ homolog subfamily C member 24
Target Function
Stimulates the ATPase activity of several Hsp70-type chaperones. This ability is enhanced by iron-binding. The iron-bound form is redox-active and can function as electron carrier. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2) which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A (Eta).
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
DPH4 family
Target Synonyms
1700030A21Rik; 2610027M02Rik; AV066965; AW240712; CSL type zinc finger containing protein 3; CSL-type zinc finger-containing protein 3; DJC24_HUMAN; DnaJ (Hsp40) homolog; subfamily C; member 24; DnaJ homolog subfamily C member 24; DNAJC24; DPH4 homolog (JJJ3; S. cerevisiae); DPH4 homolog; DPH4; JJJ3 homolog; JJJ3; MmDjC7; RGD1564710; RP23-232D1.6; ZCSL3; Zinc finger; CSL domain containing 3; Zinc finger; CSL type containing 3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
