Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DPP10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPP10 (NP_001308842.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DPP10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPP10 (NP_001308842.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00205A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DPP10 |
| Target Synonyms | DPL2; DPPY; DPRP3; DPRP-3; DPP10 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPP10 (NP_001308842.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GYIASMILKSDEKLFKCGSVVAPITDLKLYASAFSERYLGMPSKEESTYQAASVLHNVHGLKEENILIIHGTADTKVHFQHSAELIKHLIKAGVNYTMQVY | Uniprot ID | Q8N608 |
Uniprot Id
Q8N608
Target Species
Human
Target Name
DPP10
Target Full Name
Inactive dipeptidyl peptidase 10
Target Function
Promotes cell surface expression of the potassium channel KCND2. Modulates the activity and gating characteristics of the potassium channel KCND2. Has no dipeptidyl aminopeptidase activity.
Target Involvement
Asthma (ASTHMA)
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Protein Families
Peptidase S9B family, DPPIV subfamily
Target Tissue Specificity
Found in serum, T-cells and brain (at protein level). Expressed in brain, pancreas, spinal cord and adrenal glands.
Target Synonyms
Dipeptidyl peptidase 10 ; Dipeptidyl peptidase 10 non functional; Dipeptidyl peptidase IV related protein 3; Dipeptidyl peptidase IV-related protein 3; Dipeptidyl peptidase like protein 2; Dipeptidyl peptidase X; Dipeptidyl peptidase-like protein 2; Dipeptidylpeptidase 10; DPL 2; DPL2; DPP 10; DPP X; Dpp10; DPP10_HUMAN; DPPY; DPRP 3; DPRP-3; DPRP3; Inactive dipeptidyl peptidase 10; KIAA1492
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
