-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EDA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 62-182 of human EDA (NP_001390.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against EDA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 62-182 of human EDA (NP_001390.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04242A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EDA |
| Target Synonyms | ED1; HED; EDA1; EDA2; HED1; ODT1; XHED; ECTD1; XLHED; ED1-A1; ED1-A2; EDA-A1; EDA-A2; TNLG7C; STHAGX1; EDA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 62-182 of human EDA (NP_001390.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LELRSELRRERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGEAALHSDSQDGHQMALLNFFFPDEKPYSEEESRRVRRNKRSKSNEGADGPVKNKKKGKKAGPP | Uniprot ID | Q92838 |
Uniprot Id
Q92838
Target Species
Human
Target Name
EDA
Target Full Name
Ectodysplasin-A
Target Function
Cytokine which is involved in epithelial-mesenchymal signaling during morphogenesis of ectodermal organs. Functions as a ligand activating the DEATH-domain containing receptors EDAR and EDA2R. May also play a role in cell adhesion.; Binds only to the receptor EDAR, while isoform 3 binds exclusively to the receptor EDA2R.; Binds only to the receptor EDA2R.
Target Involvement
Ectodermal dysplasia 1, hypohidrotic, X-linked (XHED); Tooth agenesis, selective, X-linked, 1 (STHAGX1)
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Ectodysplasin-A, secreted form]: Secreted.
Target Protein Families
Tumor necrosis factor family
Target Tissue Specificity
Not abundant; expressed in specific cell types of ectodermal (but not mesodermal) origin of keratinocytes, hair follicles, sweat glands. Also in adult heart, liver, muscle, pancreas, prostate, fetal liver, uterus, small intestine and umbilical chord.
Target Synonyms
ECTD1; Ectodermal dysplasia 1; anhidrotic ; Ectodermal dysplasia protein; Ectodermal dysplasia; anhidrotic (hypohydrotic); Ectodysplasin A; Ectodysplasin A; membrane form; Ectodysplasin A; secreted form; ECTODYSPLASIN A1 ISOFORM; ECTODYSPLASIN A2 ISOFORM; ECTODYSPLASIN; Ectodysplasin-A; ED1 A1; ED1 A2; ED1; ED1 GENE; Eda A1; Eda A2 ; eda; EDA protein; EDA protein homolog; EDA_HUMAN; EDA1; EDA1 GENE; EDA2; HED; HED1; ODT1; Oligodontia 1; secreted form; STHAGX1; Ta; Tabby; Tabby protein ; X linked anhidroitic ectodermal dysplasia protein; XHED; XLHED
Target Background
The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene.
Notification