Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against F2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-110 of human F2R (NP_001983.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against F2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-110 of human F2R (NP_001983.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12130A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | F2R |
| Target Synonyms | TR; HTR; CF2R; PAR1; PAR-1; F2R | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 42-110 of human F2R (NP_001983.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYT | Uniprot ID | P25116 |
Uniprot Id
P25116
Target Species
Human
Target Name
F2R
Target Full Name
Proteinase-activated receptor 1
Target Function
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Platelets and vascular endothelial cells.
Target Synonyms
F2R; CF2R; PAR1; TR; Proteinase-activated receptor 1; PAR-1; Coagulation factor II receptor; Thrombin receptor
Target Background
Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
