-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FADD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FADD(NP_003815.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against FADD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FADD(NP_003815.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-08412A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FADD |
| Target Synonyms | GIG3; IMD90; MORT1; FADD | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FADD(NP_003815.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAA | Uniprot ID | Q13158 |
Uniprot Id
Q13158
Target Species
Human
Target Name
FADD
Target Full Name
FAS-associated death domain protein
Target Function
Apoptotic adaptor molecule that recruits caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation. Active caspase-8 initiates the subsequent cascade of caspases mediating apoptosis. Involved in interferon-mediated antiviral immune response, playing a role in the positive regulation of interferon signaling.
Target Involvement
Infections, recurrent, associated with encephalopathy, hepatic dysfunction and cardiovascular malformations (IEHDCM)
Target Tissue Specificity
Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes.
Target Research Area
Others
Target Synonyms
FADD; FADD protein; FADD_HUMAN; Fas (TNFRSF6) associated via death domain; Fas associated via death domain; Fas associating death domain containing protein; Fas associating protein; Fas associating protein with death domain; Fas TNFRSF6 associated via death domain; FAS-associated death domain protein; FAS-associating death domain-containing protein; GIG 3; GIG3; Growth inhibiting gene 3 protein; Growth-inhibiting gene 3 protein; H sapiens mRNA for mediator of receptor induced toxicity; Mediator of receptor induced toxicity; MGC8528; MORT 1; MORT1; Protein FADD
Target Background
The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development.
Notification