Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPAM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 630-730 of human GPAM(NP_065969.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPAM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 630-730 of human GPAM(NP_065969.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08328A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPAM |
| Target Synonyms | GPAM; GPAT; GPAT1; glycerol-3-phosphate acyltransferase; mitochondrial | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 630-730 of human GPAM(NP_065969.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQRLLGPLLE | Uniprot ID | Q9HCL2 |
Uniprot Id
Q9HCL2
Target Species
Human
Target Name
GPAM
Target Full Name
Glycerol-3-phosphate acyltransferase 1, mitochondrial
Target Function
Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipids biosynthesis such as triglycerides, phosphatidic acids and lysophosphatidic acids.
Target Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Target Protein Families
GPAT/DAPAT family
Target Synonyms
Glycerol 3 phosphate acyltransferase 1 mitochondrial; Glycerol 3 phosphate acyltransferase mitochondrial; Glycerol-3-phosphate acyltransferase 1; Gpam; GPAT; GPAT-1; GPAT1; GPAT1_HUMAN; KIAA1560; MGC26846; mitochondrial; RP11-426E5.2
Target Background
This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathway's first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
