-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Hemoglobin subunit alpha (HBA1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hemoglobin subunit alpha (Hemoglobin subunit alpha (HBA1)) (NP_000549.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Hemoglobin subunit alpha (HBA1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hemoglobin subunit alpha (Hemoglobin subunit alpha (HBA1)) (NP_000549.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05574A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Hemoglobin subunit alpha (HBA1) |
| Target Synonyms | HBH; ECYT7; HBA-T3; METHBA; Hemoglobin subunit alpha (HBA1) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hemoglobin subunit alpha (Hemoglobin subunit alpha (HBA1)) (NP_000549.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK | Uniprot ID | P69905 |
Uniprot Id
P69905
Target Species
Human
Target Name
HBA1
Target Full Name
Hemoglobin subunit alpha
Target Function
Involved in oxygen transport from the lung to the various peripheral tissues.
Target Involvement
Heinz body anemias (HEIBAN); Alpha-thalassemia (A-THAL); Hemoglobin H disease (HBH)
Target Protein Families
Globin family
Target Tissue Specificity
Red blood cells.
Target Synonyms
HBH; ECYT7; HBA-T3; METHBA; Hemoglobin subunit alpha (HBA1)
Target Background
The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported.
Notification