-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HEYL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HEYL (NP_055386.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HEYL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HEYL (NP_055386.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06869A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HEYL |
| Target Synonyms | HEY3; HRT3; HESR3; bHLHb33; HEYL | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, MDA-MB-231, Molt-4(Negative control), U266 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HEYL (NP_055386.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHA | Uniprot ID | Q9NQ87 |
Uniprot Id
Q9NQ87
Target Species
Human
Target Name
HEYL
Target Full Name
Hairy/enhancer-of-split related with YRPW motif-like protein
Target Function
Downstream effector of Notch signaling which may be required for cardiovascular development. Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3'. Represses transcription by the cardiac transcriptional activators GATA4 and GATA6.
Target Subcellular Location
Nucleus.
Target Protein Families
HEY family
Target Synonyms
bHLHb33; Class B basic helix loop helix protein 33; Class B basic helix-loop-helix protein 33; Hairy enhancer of split related with YRPW motif like; Hairy related transcription factor 3; Hairy-related transcription factor 3; Hairy/enhancer of split related with YRPW motif 3; Hairy/enhancer of split related with YRPW motif like; Hairy/enhancer of split related with YRPW motif like protein; Hairy/enhancer-of-split related with YRPW motif-like protein; HEY like protein; HEY3; heyl; HEYL protein; HEYL_HUMAN; hHeyL; hHRT3; HRT 3; HRT-3; HRT3; MGC12623
Target Background
This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.
Notification