Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HHAT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HHAT (NP_060664.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HHAT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HHAT (NP_060664.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05231A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HHAT |
| Target Synonyms | Skn; NNMS; SKI1; MART2; HHAT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, K-562, Mouse brain, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HHAT (NP_060664.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLY | Uniprot ID | Q5VTY9 |
Uniprot Id
Q5VTY9
Target Species
Human
Target Name
HHAT
Target Full Name
Protein-cysteine N-palmitoyltransferase HHAT
Target Function
Palmitoyl acyltransferase that catalyzes N-terminal palmitoylation of SHH; which is required for SHH signaling. Promotes the transfer of palmitoyl-CoA from the cytoplasmic to the luminal side of the endoplasmic reticulum membrane, where SHH palmitoylation occurs.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
Membrane-bound acyltransferase family, HHAT subfamily
Target Tissue Specificity
Ubiquitously expressed in normal tissues and cancer cell lines.
Target Synonyms
2810432O22Rik; AC115917.1; AI462858; FLJ10724; FLJ34867; Hedgehog acyltransferase; Hhat; HHAT_HUMAN; MART 2; MART-2; MART2; Melanoma antigen recognized by T cells 2; Melanoma antigen recognized by T-cells 2; MGC11697; OTTMUSP00000033669; Protein cysteine N palmitoyltransferase HHAT; Protein-cysteine N-palmitoyltransferase HHAT; RGD1311746; SKI1; Skinny hedgehog protein 1; Skinny hedgehog protein; Skn
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
