Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXA10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 236-336 of human HOXA10 (NP_061824.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXA10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 236-336 of human HOXA10 (NP_061824.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12065A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXA10 |
| Target Synonyms | PL; HOX1; HOX1H; HOX1.8; HOXA10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HT-29, Rat kidney, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 236-336 of human HOXA10 (NP_061824.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSG | Uniprot ID | P31260 |
Uniprot Id
P31260
Target Species
Human
Target Name
HOXA10
Target Full Name
Homeobox protein Hox-A10
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to the DNA sequence 5'-AA[AT]TTTTATTAC-3'.
Target Subcellular Location
Nucleus.
Target Protein Families
Abd-B homeobox family
Target Synonyms
Centaurin alpha 1 like ; Homeo box A10 ; Homeobox A10; Homeobox protein 1H ; Homeobox protein Hox A10; Homeobox protein Hox-1.8; Homeobox protein Hox-1H; Homeobox protein Hox-A10; Homeobox protein HOXA10 ; HOX 1; HOX 1.8; HOX 1H; HOX A10; HOX1; HOX1.8; HOX1H ; HOXA 10; HOXA10; HOXA10 protein; HXA10_HUMAN; MGC12859; PL
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
